DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and MYL5

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_006713949.1 Gene:MYL5 / 4636 HGNCID:7586 Length:328 Species:Homo sapiens


Alignment Length:228 Identity:44/228 - (19%)
Similarity:85/228 - (37%) Gaps:56/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 PNASVP--------PPAVLEAASVVVKQE---KLQQEQASAAKENSLMSDVELSKPGRSFEQCKQ 379
            |:||.|        |...|.:.:...:.|   |.::::..|.:.....|:|..:......::.|:
Human   128 PSASWPCVHTPDCGPGRTLSSCAERRRPEASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKE 192

  Fly   380 TF---DSRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEFEAQAPERVQIRFHDFNVPTEH 441
            .|   |.  |:.|..|...|.....:||...:.... |....: ||..|    |.|..|      
Human   193 AFTLMDQ--NRDGFIDKEDLKDTYASLGKTNVKDDE-LDAMLK-EASGP----INFTMF------ 243

  Fly   442 ENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQ-QLHLQFVGKYPPTMTNKV---- 501
                       |::..|.....:.:|.:..||  |.|...|: :::.:::.:...:..:|:    
Human   244 -----------LNLFGEKLSGTDAEETILNAF--KMLDPDGKGKINKEYIKRLLMSQADKMTAEE 295

  Fly   502 --QYYGFRA-------EYRFLTNFGIMSGIQKE 525
              |.:.|.:       :|:.| ::.|..|.:||
Human   296 VDQMFQFASIDVAGNLDYKAL-SYVITHGEEKE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 19/111 (17%)
CUB 527..644 CDD:238001
MYL5XP_006713949.1 FRQ1 170..314 CDD:227455 29/170 (17%)
EFh 189..247 CDD:238008 17/82 (21%)
EFh 263..314 CDD:238008 8/52 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.