DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and tld

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster


Alignment Length:686 Identity:134/686 - (19%)
Similarity:240/686 - (34%) Gaps:200/686 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NGQSQQAVTNSKQSHFWLDCSCLHLSERNATQWG--------RLAINASHSLGAKNNCLMI---- 84
            ||..:|.::..                ||..::|        .:..:..|:.|.::..::|    
  Fly   210 NGNGRQPISIG----------------RNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGN 258

  Fly    85 FIAGMDDELVAFQLEQLQLRAGCLDSVDIFPYLREPVIENATLAADTFCQHSRERSATPI-YSAG 148
            .:.|.:........|::.|        .:.||....::.   .|.::|.:.....:.||| ...|
  Fly   259 IMRGQEYNFDVLSPEEVDL--------PLLPYDLNSIMH---YAKNSFSKSPYLDTITPIGIPPG 312

  Fly   149 RLLGLRLRFQQPPTDLASWNL-----TLNASYRFLKRENFRTDGRLV-PHSFCDFYFFAS--LSG 205
            ..|.|..|.:....|:...||     :...:|:       :..|.:| ||    |.:..:  ||.
  Fly   313 THLELGQRKRLSRGDIVQANLLYKCASCGRTYQ-------QNSGHIVSPH----FIYSGNGVLSE 366

  Fly   206 EEANMGQGYFHSPQFPAHYPAHI-KCAYKFIGRPDTHVEILFEELQLPPVVSGGCQLDALTLFDA 269
            .|.:...|  ..|...:.:.|.: .|.::........|.:..::|.|  :.|..|..|.|.:.|.
  Fly   367 FEGSGDAG--EDPSAESEFDASLTNCEWRITATNGEKVILHLQQLHL--MSSDDCTQDYLEIRDG 427

  Fly   270 ESAHMNSVIDVICSSRPTRRLVSTGPDLLLEFNASSNRTAKGFRG-KYKFVSNDLGVPNASVPPP 333
             ..|.:.::..||.: .:..:::|....:| .|..:...|||:|| |.:|               
  Fly   428 -YWHKSPLVRRICGN-VSGEVITTQTSRML-LNYVNRNAAKGYRGFKARF--------------- 474

  Fly   334 AVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFDSRVNKSGIFDSNQLLL 398
                                    |.....|::|:| .:|.:......|...:|           
  Fly   475 ------------------------EVVCGGDLKLTK-DQSIDSPNYPMDYMPDK----------- 503

  Fly   399 AKHALGGVVIGGSRVLQCRYEFEAQAPERVQIRFHDFNVPTEHENSTGC-----QPGDALHVVTE 458
                            :|.:...|....:|.::|..|    |.|...||     :..|..|..:.
  Fly   504 ----------------ECVWRITAPDNHQVALKFQSF----ELEKHDGCAYDFVEIRDGNHSDSR 548

  Fly   459 LRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRA-------EYRFLTNF 516
            |.||:      ||..||..:.:...|::::||.      .:.||..||.|       |.:| |:.
  Fly   549 LIGRF------CGDKLPPNIKTRSNQMYIRFVS------DSSVQKLGFSAALMLDVDECKF-TDH 600

  Fly   517 GIMS------GIQKEGCSFVYN----------------SSERISGLFHSPNFPGYYLENVVCNYY 559
            |...      |..:.||...|.                .:.:.:|..:||::|..|..:..|.:.
  Fly   601 GCQHLCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPDVYPNSKQCVWE 665

  Fly   560 FYGASDERVVLHFTYFDIEG----IGSCDHQTASDYIEFSNFMSTDR--KFSRYCG-KLPDFEMR 617
            .....:..|.|:|::||:||    ...|::    ||:...:.|..:|  |...||| :||.. :.
  Fly   666 VVAPPNHAVFLNFSHFDLEGTRFHYTKCNY----DYLIIYSKMRDNRLKKIGIYCGHELPPV-VN 725

  Fly   618 SDGRFFRVTLHSNDRFVAIGFRALYTFET--VSVNN 651
            |:....|:..:|:......||.|.:..:.  .|:||
  Fly   726 SEQSILRLEFYSDRTVQRSGFVAKFVIDVDECSMNN 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 28/126 (22%)
CUB <414..512 CDD:238001 27/109 (25%)
CUB 527..644 CDD:238001 32/139 (23%)
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 26/154 (17%)
Astacin 144..339 CDD:279708 26/155 (17%)
CUB 388..474 CDD:214483 21/90 (23%)
CUB 478..586 CDD:278839 31/151 (21%)
FXa_inhibition 595..630 CDD:291342 7/35 (20%)
CUB 634..750 CDD:278839 30/120 (25%)
FXa_inhibition 757..792 CDD:291342 3/5 (60%)
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.