DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and CG42613

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001247185.1 Gene:CG42613 / 42269 FlyBaseID:FBgn0261262 Length:1188 Species:Drosophila melanogaster


Alignment Length:662 Identity:157/662 - (23%)
Similarity:262/662 - (39%) Gaps:157/662 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SHSLGAKNNCLMIFIAGMDDELVAFQLEQLQLRA------------GCL-DSVDIFPYLREPVIE 123
            :||    ..||..|:|| ..:.|....:...||.            .|: :.:||:..::..  |
  Fly   297 NHS----RQCLYTFLAG-PGQRVEVVFKSFNLRGSPPDGSAVGELPSCVHEYMDIYSEVQSS--E 354

  Fly   124 NATLAADTF----CQHSRERSATPIYSAGRLLGLRLRF---QQPPTDLASWNLTLNASYRFLKRE 181
            .|.|....|    |.....|....:|.|     :.:.|   :...|||      ...::||:...
  Fly   355 PAELINSPFGGRYCGTIPPRRRISMYRA-----VAISFFSNKNVTTDL------FEGTFRFINAS 408

  Fly   182 NFRTDGRLVPHSFCDFYFFASLSGEEANMGQGYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILF 246
            .:.. |..:..|.|.:....|:|..:.    |...||.:|..||..:.|.|:|:|..:..|.:.|
  Fly   409 EYEI-GIPIAGSPCSYTITPSMSVNKT----GALISPTYPGAYPKDMSCTYQFLGESNQRVRLEF 468

  Fly   247 EELQLPPVVSGG--CQLDALTLFDAESAHMNSVIDVICSSRPTRRLVSTGPDLLLEF---NASSN 306
            .:..|   ..||  |..|.:.::|... :.:::|...|..:....|.|:...|.:.|   :.::|
  Fly   469 RDFDL---FFGGPHCPFDYVKVYDGPD-NSSALIGTYCGQQRNLVLYSSESSLFVHFYTLSRTAN 529

  Fly   307 RTAKGFRGKYKFVSNDLGVPNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPG 371
            ...:||:|.|:|                    :...||.:.:::......:.:            
  Fly   530 TQNRGFKGIYEF--------------------SESFVKLDFIRENDGIHIRGS------------ 562

  Fly   372 RSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQ------CRYEF----EAQAPE 426
                :|                :|.:|:|....|.|:..:....      |||..    :||..|
  Fly   563 ----EC----------------DQKILSKKESTGFVLSPNYPYPYIPKTVCRYFIYGMQDAQHLE 607

  Fly   427 RVQIRFHDFNVP-TEH--ENSTGCQPGDALHVVTELRGRYETQEL-------LCGAFLPKPLMSS 481
            ||::.|:.||:| .||  ::.:.|..|   ::...|:|: ||.:.       |||....: ::|.
  Fly   608 RVRLEFNAFNIPKVEHKDKSESNCTDG---YLKIYLKGQ-ETADAYDKFDYELCGNETQR-VISE 667

  Fly   482 GQQLHLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEG-CSFVYNSSERISGLFHSPN 545
            |.:|.:.|       .:.::|..||:.:|.|.|.:.|......:| |||.|.||.:..|..:||.
  Fly   668 GPRLAMVF-------SSGELQGRGFKGKYTFETEYKIPGTAAPDGTCSFTYVSSSKKRGELNSPR 725

  Fly   546 FPGYYLENVVCNYYFYGASDERVVLHFTYFDIE------------GIGSCDHQTASDYIEFSNFM 598
            :|..|..:..|:|.|...:||:|.:.|.:|.|:            |.|:|.......|:.:.:  
  Fly   726 YPSNYPSDTNCSYLFLAEADEQVTIVFDHFKIKADNNANATAGAYGSGACFEDWLEMYVVYRD-- 788

  Fly   599 STDRKFSRYCGKLPDFEMRSD-GRF-FRVTLHSNDRFVAIGFRALYTFETVSVNNSITDLRDNAS 661
            :.||...||||:.....:.|. |.. .|:|||::...||.||:|.|.||  |..:...|...|.|
  Fly   789 NNDRLLGRYCGQTAPGPVESPRGAVGLRITLHTDQESVASGFKARYFFE--SAKSDAGDCGGNFS 851

  Fly   662 MQSFVSTASTQP 673
            .|.  |...|.|
  Fly   852 NQD--SGLITSP 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 32/127 (25%)
CUB <414..512 CDD:238001 31/117 (26%)
CUB 527..644 CDD:238001 42/130 (32%)
CG42613NP_001247185.1 CUB 277..404 CDD:238001 25/124 (20%)
CUB 421..541 CDD:238001 32/127 (25%)
CUB 564..691 CDD:238001 37/154 (24%)
CUB 707..836 CDD:238001 42/130 (32%)
CUB 846..969 CDD:238001 6/18 (33%)
LDLa 987..1022 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47537
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.