DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and CG42255

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster


Alignment Length:741 Identity:143/741 - (19%)
Similarity:252/741 - (34%) Gaps:253/741 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IAG-MDDELVAFQLEQ---LQLRAGCLDSVDIFP-----YLREPVIENATLAAD---TFCQHSRE 138
            |:| |:.|:..:.:||   .|::. .:|.|.:..     ||:..:.:..:..|.   ..|....|
  Fly   756 ISGYMNFEVCLYLIEQPRGTQVKL-VIDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEE 819

  Fly   139 RSATPIYSAGRLLGLRLRFQQPPTDLA-SWNLTLNASYRFLKRENFRTDGRLVPHSFCDFYFFAS 202
            ....||.|.|.::.:|..:......|: |::||    |..:...||.|:                
  Fly   820 SELEPIISIGNVILVRYEYALSGVRLSKSFDLT----YTRVCTGNFNTN---------------- 864

  Fly   203 LSGEEANMGQGYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVVSGGCQLDALTLF 267
                     .|...:|.:|..|...:.|.|...|..||.|.:               ::..|:|.
  Fly   865 ---------SGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRM---------------RITDLSLG 905

  Fly   268 DAESAHMNSVIDVICSSRPTRRLVSTGPDLLLEFNASSNRTA---------KGFRGKYKFVSNDL 323
            .|.:.:..|.:||..|:...|.:|.:..:|:|  .:.|||.:         :|.|.:|.||.|..
  Fly   906 TANNENDTSYLDVYLSADQKRHIVKSTDNLIL--LSHSNRASLVFHGSGGGRGMRLEYNFVPNQC 968

  Fly   324 GVPNASVPPPAVLEAASV---------------VVKQEKLQQEQASAAKENSLMSDVELSKPGRS 373
            |   ..:..|......:|               .:....|....:.:..:||       :.||: 
  Fly   969 G---GFLNEPGRRYVTAVRGTFCQWFIDFPGRKKISIHTLGPTPSISIYDNS-------TSPGK- 1022

  Fly   374 FEQCKQTFDSRVNK-SG----IFDSNQLLLAKH-------------------ALGGVV------- 407
                      .||. ||    :||.:.|.:..|                   :.||..       
  Fly  1023 ----------LVNSYSGSVGDVFDGDLLTINLHTNWPRLEIYSIQFDIVQQDSCGGTFTARFGYI 1077

  Fly   408 --------IGGSRVLQCRYEFEAQAPERVQIRFHDFNVPTEHENSTGC-------QPGDALHVVT 457
                    .|.|::  |.:...|....|:::..|:|.:..|: :||||       :.||:  ..:
  Fly  1078 KSPNWPKNYGESQM--CEWILRAPFGHRIELVVHNFTLEEEY-SSTGCWTDWLEIRNGDS--ESS 1137

  Fly   458 ELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGI 522
            .|.|||      ||..:|..:.|.|..|||:|  |...:|..|          .||.::..|.. 
  Fly  1138 PLIGRY------CGNEIPSRIPSFGNVLHLKF--KSDDSMEEK----------GFLLSWQQMGA- 1183

  Fly   523 QKEGCSFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVL------------HFTYF 575
               ||....:||   .|..|||:........:.|::....|...||.|            ..|.:
  Fly  1184 ---GCGGKLSSS---MGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQLRSNDNRICSGQLTLY 1242

  Fly   576 D--------------------IEGIGS---CDHQTASDYIEFSNFMSTDRKFSRYC--------- 608
            |                    ::..|:   ..:....|..:.::||   ..:...|         
  Fly  1243 DGPTTASNPIVIRCNGTIAKPLQSTGNRVLVRYDVGHDAPDGTDFM---LNYQTNCRVRLEGLQG 1304

  Fly   609 -------------GKLPDFEMRSDGRFFRVTLHSNDRFVAIGFRALYTFETVSVNN--SITDLRD 658
                         |:..::::|:.||       .|...:.....::..|.::.:|:  |:.|:.|
  Fly  1305 AIETPNFPENYPPGQDCEWDIRAGGR-------KNHLQLIFSHLSVEKFSSICLNDYVSLVDMLD 1362

  Fly   659 NASM--QSFVSTASTQPVANV-NKLI 681
            :.::  |...:....:|:..| |:|:
  Fly  1363 DQTLSEQHLCTNDGLEPITTVGNRLL 1388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 27/131 (21%)
CUB <414..512 CDD:238001 28/104 (27%)
CUB 527..644 CDD:238001 24/173 (14%)
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001 23/102 (23%)
CUB 857..963 CDD:238001 30/147 (20%)
CUB 1066..1179 CDD:238001 34/135 (25%)
CUB 1185..1293 CDD:238001 18/113 (16%)
CUB 1303..1406 CDD:238001 15/93 (16%)
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.