DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Tll2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001178827.1 Gene:Tll2 / 365460 RGDID:1559756 Length:1014 Species:Rattus norvegicus


Alignment Length:460 Identity:99/460 - (21%)
Similarity:170/460 - (36%) Gaps:114/460 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVVSGG--CQLDALTLFDAES--AH 273
            |...||.:|..||.:..|.::.:......:.:.||..:|    .|.  |:.|.:.:....|  |.
  Rat   628 GTITSPGWPKEYPTNKNCVWQVVAPMQYRISLQFEAFEL----EGNDVCKYDFVEVRSGLSPDAK 688

  Fly   274 MNSVIDVICSSRPTRRLVSTGPDLLLEFNASSNRTAKGFRGKYKFVSNDLGVPNASVPPPAVLEA 338
            ::.   ..|.|.....:.|...::.:||.:.:..:.:|||..: |...|                
  Rat   689 LHG---KFCGSETPEVITSQSNNMRVEFKSDNTVSKRGFRAHF-FSDKD---------------- 733

  Fly   339 ASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFDS---------RVNKSGIFDSN 394
                           ..||:|           |...::|..||.|         |::::| .|..
  Rat   734 ---------------ECAKDN-----------GGCQQECVNTFGSYLCRCRNGYRLHENG-HDCK 771

  Fly   395 QLLLA---KHALGGVVIGG------SRVLQCRYEFEAQAPERVQIRFHDFNVPTEHENSTGC--- 447
            :...|   ..|.|.::...      || .:|.:...:.|..||:|.|.:|.|....|    |   
  Rat   772 EAGCAYKISSAEGTLMSPNWPDKYPSR-KECTWNISSTAGHRVKITFSEFEVEQHQE----CAYD 831

  Fly   448 --QPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEY 510
              :..|.......:.||:      ||:..|.|::::|..|.|:|..      ...||..||:|.:
  Rat   832 HLELYDGTDSSAPILGRF------CGSKKPDPVVATGSSLFLRFYS------DASVQRKGFQAVH 884

  Fly   511 RFLTNFGIMSGIQ-KEGCSFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTY 574
            .......:.:.:| ||    :|:.::     |...|:|    ....|::.........|.|.|..
  Rat   885 STECGGRLKAEVQTKE----LYSHAQ-----FGDNNYP----SQAHCDWVIVAEDGYGVELVFRT 936

  Fly   575 FDIEGIGSCDHQTASDYIE-FSNFMSTDRKFSRYCGKLPDFEMRSDGRFFRVTLHSNDRFVAIGF 638
            |::|....|.:    ||:| :..:.|:..:..|:||..|..|:.|.|....:..|::|.....||
  Rat   937 FEVEEEADCGY----DYLEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIHFHTDDTINKKGF 997

  Fly   639 RALYT 643
            .|.||
  Rat   998 HARYT 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 23/108 (21%)
CUB <414..512 CDD:238001 26/102 (25%)
CUB 527..644 CDD:238001 29/118 (25%)
Tll2NP_001178827.1 ZnMc_BMP1_TLD 149..348 CDD:239808
Astacin 156..349 CDD:279708
CUB 350..459 CDD:278839
CUB 463..572 CDD:278839
FXa_inhibition 583..615 CDD:291342
CUB 619..728 CDD:278839 23/106 (22%)
FXa_inhibition 735..770 CDD:291342 10/46 (22%)
CUB 775..884 CDD:278839 31/125 (25%)
CUB 888..1001 CDD:278839 30/129 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.