DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and OVCH2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:323 Identity:72/323 - (22%)
Similarity:120/323 - (37%) Gaps:74/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 CKQTFDSRVNKS-----GIF-DSNQLL--LAKHALGG--------------VVIGGSRVLQCRYE 419
            |.:.:.:.|.||     ||| |.:::|  :.:|...|              |::.|:       |
Human   269 CGRGWRNNVRKSDQGSPGIFTDISKVLPWIHEHIQTGNRRKSSRAWCSEQDVIVSGA-------E 326

  Fly   420 FEAQAPERVQIRFHD-------FNVPTE--------HENSTGCQPGDALHVVTELR--GRYETQE 467
            .:...||.:.:.:..       ..||.|        |.:...|..........|.|  |::    
Human   327 GKLHFPESLHLYYESKQRCVWTLLVPEEMHVLLSFSHLDVESCHHSYLSMYSLEDRPIGKF---- 387

  Fly   468 LLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEYRFL-TNFGIMSGIQKEGCSFVY 531
              ||..||..::.....|.|:||........      ||...|:.| .|:     |...|||::.
Human   388 --CGESLPSSILIGSNSLRLKFVSDATDNAA------GFNLTYKALKPNY-----IPDSGCSYLT 439

  Fly   532 NSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASDYIEFSN 596
            ...|  .||..|.|:|..|.:...|::.|..:....:.|.|...:||..|.|    .|||:...:
Human   440 VLFE--EGLIQSLNYPENYSDKANCDWIFQASKHHLIKLSFQSLEIEESGDC----TSDYVTVHS 498

  Fly   597 FMSTDRKFSRYCGKLPDFEMRSDGRFFRVTLHSNDRFVAIGFRALYTFETVSV----NNSITD 655
            .:...::.:|.||......:.|......::..|::.....||:|..:|...:|    |.||::
Human   499 DVERKKEIARLCGYDVPTPVLSPSSIMLISFQSDENGTCRGFQATVSFIPKAVYPDLNISISE 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 22/114 (19%)
CUB 527..644 CDD:238001 28/116 (24%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 9/28 (32%)
Tryp_SPc 56..301 CDD:238113 9/31 (29%)
CUB 320..424 CDD:238001 24/122 (20%)
CUB 435..546 CDD:238001 28/116 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.