DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Cubn

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster


Alignment Length:554 Identity:125/554 - (22%)
Similarity:195/554 - (35%) Gaps:174/554 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 NFRTDGRLVPHSFCDFYFFASLSGEEANMGQGYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILF 246
            ::|.||.:                ||.....|:|.||.:|..||.:::|.:......|:.:|:..
  Fly  1433 DYRIDGCM----------------EELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTI 1481

  Fly   247 EELQLPPVVSGGCQLDALTLFDAESAHMNS--VIDVICSSRPTRRLVSTGPDLLLEFNASSNRTA 309
            ..:.|..  |..|..||||:    |.|.||  |.:..|.|.....:.|:|..|.:.|.:.::...
  Fly  1482 NNIDLED--SPNCTKDALTV----SNHKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNG 1540

  Fly   310 KGFRGKYKFVSNDLG-----------VPNASVPPPA----------------VLEAASVVVKQ-- 345
            .||...|:.|....|           .||..:..||                |.|.|.:.::.  
  Fly  1541 LGFEATYRTVKATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGY 1605

  Fly   346 -------------------EKLQQEQASAAKENSLM------------SDVELSKPG---RSFEQ 376
                               |:|.:......:::.|:            ||..:||.|   ...|.
  Fly  1606 DCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHFHES 1670

  Fly   377 CKQTFDSRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEFEAQAPER--------VQIRFH 433
            |.||.   :....:||..|  :::.|        :|...|.:.|:|..|.:        |::| .
  Fly  1671 CGQTI---IVDETMFDYIQ--MSRQA--------ARNESCLWVFQAVEPNKRIIFTPTHVKLR-E 1721

  Fly   434 DFN--VPTEHENSTGCQPGDALHVVTELRGRYETQE-------LLCGAFLPKPLMSSGQ------ 483
            |.|  .|||         ||.|:|..::   ||..|       ..|.:. |..|:|:||      
  Fly  1722 DANQQYPTE---------GDCLNVGVKI---YEGTEPQGTPRLKFCRSH-PPALISNGQALTVSV 1773

  Fly   484 --QLHLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEGCSFVYNSSERISGLFHSPNF 546
              ||..:|.|.|....|:                           |..:||:   :||.|.||.:
  Fly  1774 PLQLVEEFQGHYMTMDTS---------------------------CGSIYNA---LSGKFTSPYY 1808

  Fly   547 PGYYLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASDYIEFSNFMSTDRKFSRYCGKL 611
            |..|..|:.|.:....:....:.|.....|:|...||:.    ||:|......:.:....|||..
  Fly  1809 PASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNR----DYLEVREESESGQLIGVYCGNE 1869

  Fly   612 PDFEMRSDGRFFRVTLHSNDRFVAIGFRALYTFE 645
            ....:.|.|..: :...|:|..|..||.|.|.:|
  Fly  1870 VPGVIHSRGAIW-MKFKSDDDNVGEGFMASYNYE 1902

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 33/124 (27%)
CUB <414..512 CDD:238001 30/122 (25%)
CUB 527..644 CDD:238001 32/116 (28%)
CubnNP_727348.2 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 282..322 CDD:214542
EGF_3 328..366 CDD:289699
EGF 430..457 CDD:278437
EGF_CA 469..503 CDD:238011
CUB 509..622 CDD:238001
CUB 627..737 CDD:238001
CUB 744..849 CDD:294042
CUB 853..970 CDD:238001
CUB 978..1094 CDD:238001
CUB 1100..1211 CDD:238001
CUB 1216..1330 CDD:238001
CUB 1446..1549 CDD:238001 31/108 (29%)
CUB 1554..1667 CDD:238001 16/112 (14%)
CUB 1792..1899 CDD:238001 31/114 (27%)
CUB 1910..1998 CDD:294042
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.