DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Ovch2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:280 Identity:57/280 - (20%)
Similarity:99/280 - (35%) Gaps:67/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 LGGVVIGGSRVLQCRYEFEAQAPERVQIRFHD-------FNVPTEHENSTGCQPGDALHVVTELR 460
            |.|::.|.        |.|...||.:.:.:..       |.||.:            :|::..|.
  Rat   314 LDGLISGS--------EGELHFPESLHLYYESKQLCVWTFLVPED------------MHMLFNLS 358

  Fly   461 ------------GRYETQELL----CGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAE 509
                        ..|..::.|    ||..||..::.....:.|:|:.......|      ||...
  Rat   359 HLDVESCHHNYLAMYSLEDRLVGKFCGESLPSSILIGSSSIQLRFISDATDYAT------GFNLT 417

  Fly   510 YRFLTNFGIMSGIQKEGCSFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTY 574
            |:.|.    .|.....||..:....|  .|...|.::|..|.:...|.:.|...:...:.|.|..
  Rat   418 YKALK----PSYHPDSGCRSLTILFE--EGTIQSLHYPEEYSDMASCTWIFQAPNHFLIKLSFQS 476

  Fly   575 FDIEGIGSCDHQTASDYIEFSNFMSTDRKFSRYCGKLPDFEMRS---DGRFFRVTLHSNDRFVAI 636
            .:||..|.|    .|||:...:.:..:.:.:|:||    :|:.|   ......:...|::...:.
  Rat   477 LEIEENGDC----TSDYVTVYSDVERENEIARFCG----YEVPSPVLSSSVMLINFQSDENGTSR 533

  Fly   637 GFRALYTF-ETVSVNNSITD 655
            ||:|..:| .....|.||::
  Rat   534 GFQADVSFISRADFNISISE 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 21/120 (18%)
CUB 527..644 CDD:238001 26/119 (22%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113
CUB 317..420 CDD:238001 22/128 (17%)
CUB 431..541 CDD:238001 26/119 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.