DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and myl7

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_571404.1 Gene:myl7 / 30592 ZFINID:ZDB-GENE-991019-3 Length:172 Species:Danio rerio


Alignment Length:153 Identity:32/153 - (20%)
Similarity:53/153 - (34%) Gaps:60/153 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SERNATQWGRLAINASHSLGAKNNCLMIFIAGMDDELVAFQLEQLQLRAGCLDSVDIFPYLREPV 121
            |::.|.:.|:.|...|      :|...:|...        |:::.:...||:|.      .|:.|
Zfish     3 SKKAAAKRGKTAQRGS------SNVFSMFEQS--------QIQEFKEAFGCIDQ------NRDGV 47

  Fly   122 IENATLAADTFCQHSRERSATPIYSAGRLLGLRLRFQQPPTDLASWNLTLNASYRFLKRENFRTD 186
            |..:.| .:|:.|                ||                 .||.|...|  |:..|:
Zfish    48 INKSDL-KETYAQ----------------LG-----------------KLNVSDEEL--ESMLTE 76

  Fly   187 GRLVPHSFCDFYFFASLSGEEAN 209
            |:    ...:|..|.:|.||:.|
Zfish    77 GK----GPINFTVFLTLFGEKLN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 6/15 (40%)
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001
myl7NP_571404.1 FRQ1 18..165 CDD:227455 28/138 (20%)
EFh 32..128 CDD:298682 24/110 (22%)
EFh 103..164 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.