DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sol1 and mylpfa

DIOPT Version :10

Sequence 1:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_571263.1 Gene:mylpfa / 30429 ZFINID:ZDB-GENE-990712-15 Length:169 Species:Danio rerio


Alignment Length:43 Identity:14/43 - (32%)
Similarity:17/43 - (39%) Gaps:14/43 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 GASDERVVLH-FTYFDIEGIGS-------------CDHQTASD 590
            ||..|.|::. |...|.||.||             ||..||.:
Zfish    94 GADPEDVIVSAFKVLDPEGTGSIKKEFLEELLTTQCDRFTAEE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sol1NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001 14/43 (33%)
mylpfaNP_571263.1 PTZ00184 22..158 CDD:185504 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.