powered by:
Protein Alignment CG34402 and Myl7
DIOPT Version :9
Sequence 1: | NP_001097756.1 |
Gene: | CG34402 / 41513 |
FlyBaseID: | FBgn0085431 |
Length: | 695 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006251278.1 |
Gene: | Myl7 / 289759 |
RGDID: | 1308262 |
Length: | 175 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 23/70 - (32%) |
Gaps: | 29/70 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 180 RENFRTDGRL-VPHSFCD-----------FYFFASLSGEEAN-----------------MGQGYF 215
:|.:...||: ||....| |..|.:|.||:.| .|||..
Rat 58 KETYSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVV 122
Fly 216 HSPQF 220
:..:|
Rat 123 NKEEF 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0031 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.