DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Kremen2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_017452551.1 Gene:Kremen2 / 287102 RGDID:1310795 Length:468 Species:Rattus norvegicus


Alignment Length:307 Identity:66/307 - (21%)
Similarity:96/307 - (31%) Gaps:82/307 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LAADTFCQHSRERSATPIYSAGRLLGLRLRFQQPPT----------------------DLASWNL 169
            |.|..||::.........|.|....|:..|:...||                      ...|..|
  Rat    82 LGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKL 146

  Fly   170 TLNASYRFLKRENFR------------------TDGRLVPHSFCDFYFF---ASLSGEEANMG-- 211
            |:....||.:.:.::                  ..||..|.:.||...|   ..|.|.:..:|  
  Rat   147 TVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRPAPATDCDQICFGHPGQLCGGDGRLGIY 211

  Fly   212 --------------QGYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVVSGGCQLD 262
                          ||..:||.||..|.....|:: .:|:....:|:.|...:|..      ..|
  Rat   212 EVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSW-VLGQLGAVLELTFRLFELAD------SRD 269

  Fly   263 ALTLFDAESAHMNSVIDVICSSRPTRRLVSTGP------DLLLEFNASSNRTAKGFRGKYKFVSN 321
            .|.|.||.|.::....|......|       ||      .|||.|.:.:...|:||...|:.:.:
  Rat   270 RLELRDASSGNLLRAFDGAHPPPP-------GPLHLRTAALLLTFRSDARGHAQGFALTYRGLQD 327

  Fly   322 ---DLGVPNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDV 365
               |...|..|....|.....:.|....|....|||...|..|.:.|
  Rat   328 TVEDRASPEDSAETLAGNPDGANVSCSPKPGAAQASIGGEADLQARV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 36/147 (24%)
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001
Kremen2XP_017452551.1 KR 33..118 CDD:214527 9/35 (26%)
WSC 123..204 CDD:280068 12/80 (15%)
CUB 218..323 CDD:238001 29/118 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.