DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and PCOLCE2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_037495.1 Gene:PCOLCE2 / 26577 HGNCID:8739 Length:415 Species:Homo sapiens


Alignment Length:335 Identity:74/335 - (22%)
Similarity:117/335 - (34%) Gaps:89/335 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 NASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQC------KQTFDSRV 385
            ||..|...:|.||:.:.:|:                      .|.|....|      :..|....
Human     5 NAWAPLCLLLAAATQLSRQQ----------------------SPERPVFTCGGILTGESGFIGSE 47

  Fly   386 NKSGIFDSNQLLLAKHAL--GGVVIGGSRVLQ------CRYEFEAQAPERVQIRFHDFNVPTEHE 442
            ...|::..|.....|..:  |.||:...|.:.      |||:|              .:|...|.
Human    48 GFPGVYPPNSKCTWKITVPEGKVVVLNFRFIDLESDNLCRYDF--------------VDVYNGHA 98

  Fly   443 NSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFR 507
            |      |..:       ||:      ||.|.|..|:|||.::.:|.:.. ..|..|     ||.
Human    99 N------GQRI-------GRF------CGTFRPGALVSSGNKMMVQMISD-ANTAGN-----GFM 138

  Fly   508 AEYRFLTNFGIMSGIQKEGCSFVYNSSERISGLFHSPNFPGY-YLENVVCNYYFYGASDERVVLH 571
            |.:.       .:...:.|..:.....:|.||.|.:||:|.. |...|.|.::.....::.:.|.
Human   139 AMFS-------AAEPNERGDQYCGGLLDRPSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELK 196

  Fly   572 FTYFDIEGIGSCDHQTASDYIEFSN--FMSTDRKFSRYCGKLPDFEMRSDGRFFRVTLHSNDRFV 634
            |..||:|....|.:    ||:...|  .::..|:..:|||..|...:.|:.....:...|:....
Human   197 FEKFDVERDNYCRY----DYVAVFNGGEVNDARRIGKYCGDSPPAPIVSERNELLIQFLSDLSLT 257

  Fly   635 AIGFRALYTF 644
            |.||...|.|
Human   258 ADGFIGHYIF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 24/103 (23%)
CUB 527..644 CDD:238001 30/119 (25%)
PCOLCE2NP_037495.1 CUB 33..143 CDD:238001 33/155 (21%)
CUB 154..267 CDD:238001 30/116 (26%)
NTR_PCOLCE 292..415 CDD:239631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4379
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.