DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Nrp1

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_659566.1 Gene:Nrp1 / 246331 RGDID:621588 Length:922 Species:Rattus norvegicus


Alignment Length:330 Identity:76/330 - (23%)
Similarity:118/330 - (35%) Gaps:93/330 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 LLLAKHALGGVVIGGSRVLQC-------------------------RYEFEAQAPE---RVQIRF 432
            ||.|..||...:.|..|..:|                         :.|:..||||   |:.|.|
  Rat     7 LLCATLALALALAGAFRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINF 71

  Fly   433 ------------HDFNVPTEHENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQL 485
                        :|:....:.||..|           .|.|::      ||...|.|::|||..|
  Rat    72 NPHFDLEDRDCKYDYVEVIDGENEGG-----------RLWGKF------CGKIAPSPVVSSGPFL 119

  Fly   486 HLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEG--CSFVYNSSERISGLFHSPNFPG 548
            .::||..|        :.:|        ..|.|...|.|.|  ||..|.:.   :|:..||.||.
  Rat   120 FIKFVSDY--------ETHG--------AGFSIRYEIFKRGPECSQNYTAP---TGVIKSPGFPE 165

  Fly   549 YYLENVVCNYYFYGASDERVVLHFTYFDIE------GIGSCDHQTASDYIE-FSNFMSTDRKFSR 606
            .|..::.|.|..:......::|.|..||:|      |...|.:    |.:| :..|........|
  Rat   166 KYPNSLECTYIIFAPKMSEIILEFESFDLEQDSNPPGGVFCRY----DRLEIWDGFPEVGPHIGR 226

  Fly   607 YCGKLPDFEMRSDGRFFRVTLHSNDRFVAIGFRALYTFETVSVNNSITDLR----DNASMQSFVS 667
            |||:.....:||......:..:::......||.|.|:....|::.....:.    ::..:.|...
  Rat   227 YCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCMEALGMESGEIHSDQI 291

  Fly   668 TASTQ 672
            |||:|
  Rat   292 TASSQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 27/137 (20%)
CUB 527..644 CDD:238001 31/123 (25%)
Nrp1NP_659566.1 CUB 27..140 CDD:238001 29/145 (20%)
CUB 147..264 CDD:238001 31/123 (25%)
FA58C 274..424 CDD:214572 5/23 (22%)
FA58C 277..423 CDD:238014 5/20 (25%)
FA58C 430..583 CDD:214572
FA58C 435..582 CDD:238014
MAM 645..804 CDD:214533
MAM 650..803 CDD:99706
DUF3481 842..919 CDD:152415
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.