DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and CDCP2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001340584.1 Gene:CDCP2 / 200008 HGNCID:27297 Length:540 Species:Homo sapiens


Alignment Length:504 Identity:99/504 - (19%)
Similarity:155/504 - (30%) Gaps:163/504 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVVSGGCQLDALTLFDAESAHMNSV 277
            |.|.||.||..||.:.:|::..:....:.|.:.|....|.  ....|..|.|.:::..|....::
Human    39 GNFSSPNFPRLYPYNTECSWLIVVAEGSSVLLTFHAFDLE--YHDTCSFDFLEIYNGASPDKGNL 101

  Fly   278 IDVICSSRPTRRLVSTGPDLLLEFNASSNRTAKGFRGKYKFVSNDLGVPNASVPPPAVLEAASVV 342
            :...|...|.....|:...:.:.|::..:..:.||...|:                         
Human   102 LGRFCGKVPPPPFTSSWHVMSVIFHSDKHVASHGFSAGYQ------------------------- 141

  Fly   343 VKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGVV 407
                                                                     |...|||:
Human   142 ---------------------------------------------------------KDVCGGVL 149

  Fly   408 IGGSRVL-------------QCRYEFEAQAPERVQIRFHDFNVPTEHENSTGCQ---------PG 450
            .|.|.||             :|.:...|..|..|::.|.||.|    |.:..|.         ||
Human   150 TGLSGVLTSPEYPNNYPNSMECHWVIRAAGPAHVKLVFVDFQV----EGNEECTYDYVAVLGGPG 210

  Fly   451 DALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEYRFLTN 515
            ..       ||.:     .||:..|..|:|.|.:|.:.|...:      .:...||:|.|     
Human   211 PT-------RGHH-----YCGSTRPPTLVSLGHELQVVFKSDF------NIGGRGFKAYY----- 252

  Fly   516 FGIMSGIQKEGCSFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTYFDIEGI 580
               .||    .|..||.:   :.|.|.||.:|..|..|:.|::........:|.:.|...|:|..
Human   253 ---FSG----ECQEVYMA---MRGNFSSPQYPSSYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEP 307

  Fly   581 GS----C--DHQTASDYIEFSNFMSTDRKFSRYCG-KLPDFEMRSDGRFFRVTLHSNDRFVAIGF 638
            .|    |  ||..|     |............:|| .||. .:.|......:.||::......||
Human   308 NSLTKTCDFDHLAA-----FDGASEEAPLLGNWCGHHLPP-PVTSSHNQLLLLLHTDRSTTRRGF 366

  Fly   639 RALYT-FETVSVNNSITDLRDNASMQSFVSTASTQPVANVNKLIACILC 686
            ...|. ...::|:.|.||      .|..:||.:..|:......:....|
Human   367 SVAYIGVVPMNVSCSRTD------FQILISTQALAPLERTKVYLGSRSC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 23/104 (22%)
CUB <414..512 CDD:238001 27/119 (23%)
CUB 527..644 CDD:238001 31/124 (25%)
CDCP2NP_001340584.1 CUB 30..141 CDD:238001 22/103 (21%)
CUB 145..254 CDD:238001 33/138 (24%)
CUB 257..370 CDD:278839 30/121 (25%)
Zona_pellucida 380..>463 CDD:332579 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.