powered by:
Protein Alignment CG34402 and Myl2
DIOPT Version :9
Sequence 1: | NP_001097756.1 |
Gene: | CG34402 / 41513 |
FlyBaseID: | FBgn0085431 |
Length: | 695 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001371255.1 |
Gene: | Myl2 / 17906 |
MGIID: | 97272 |
Length: | 166 |
Species: | Mus musculus |
Alignment Length: | 47 |
Identity: | 16/47 - (34%) |
Similarity: | 24/47 - (51%) |
Gaps: | 8/47 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 562 GASDERVVLH-FTYFDIEGIGSCDHQTASDYIEFSNFMSTD-RKFSR 606
||..|..:|: |..||.||.|| ..:||:. ..::|. .:||:
Mouse 92 GADPEETILNAFKVFDPEGKGS----LKADYVR--EMLTTQAERFSK 132
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34402 | NP_001097756.1 |
CUB |
195..318 |
CDD:238001 |
|
CUB |
<414..512 |
CDD:238001 |
|
CUB |
527..644 |
CDD:238001 |
16/47 (34%) |
Myl2 | NP_001371255.1 |
FRQ1 |
14..163 |
CDD:227455 |
16/47 (34%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0031 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.