DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sol1 and Myl2

DIOPT Version :10

Sequence 1:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_034991.3 Gene:Myl2 / 17906 MGIID:97272 Length:166 Species:Mus musculus


Alignment Length:47 Identity:16/47 - (34%)
Similarity:24/47 - (51%) Gaps:8/47 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 GASDERVVLH-FTYFDIEGIGSCDHQTASDYIEFSNFMSTD-RKFSR 606
            ||..|..:|: |..||.||.||    ..:||:.  ..::|. .:||:
Mouse    92 GADPEETILNAFKVFDPEGKGS----LKADYVR--EMLTTQAERFSK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sol1NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001 16/47 (34%)
Myl2NP_034991.3 PTZ00184 20..160 CDD:185504 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.