powered by:
Protein Alignment Sol1 and Myl7
DIOPT Version :10
| Sequence 1: | NP_001097756.1 |
Gene: | Sol1 / 41513 |
FlyBaseID: | FBgn0085431 |
Length: | 695 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_075017.2 |
Gene: | Myl7 / 17898 |
MGIID: | 107495 |
Length: | 175 |
Species: | Mus musculus |
| Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
| Similarity: | 23/70 - (32%) |
Gaps: | 29/70 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 180 RENFRTDGRL-VPHSFCD-----------FYFFASLSGEEAN-----------------MGQGYF 215
:|.:...||: ||....| |..|.:|.||:.| .|||..
Mouse 58 KETYSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVV 122
Fly 216 HSPQF 220
:..:|
Mouse 123 NKEEF 127
|
Known Domains:
Indicated by green bases in alignment.
Return to query results.
Submit another query.