DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sol1 and Myl7

DIOPT Version :10

Sequence 1:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_075017.2 Gene:Myl7 / 17898 MGIID:107495 Length:175 Species:Mus musculus


Alignment Length:70 Identity:16/70 - (22%)
Similarity:23/70 - (32%) Gaps:29/70 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 RENFRTDGRL-VPHSFCD-----------FYFFASLSGEEAN-----------------MGQGYF 215
            :|.:...||: ||....|           |..|.:|.||:.|                 .|||..
Mouse    58 KETYSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVV 122

  Fly   216 HSPQF 220
            :..:|
Mouse   123 NKEEF 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sol1NP_001097756.1 CUB 195..318 CDD:238001 11/54 (20%)
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001
Myl7NP_075017.2 PTZ00184 28..168 CDD:185504 16/70 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.