DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and AgaP_AGAP001415

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_321719.5 Gene:AgaP_AGAP001415 / 1281762 VectorBaseID:AGAP001415 Length:887 Species:Anopheles gambiae


Alignment Length:688 Identity:161/688 - (23%)
Similarity:259/688 - (37%) Gaps:178/688 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLTMPAASLALGLTVVLLATG--NGQSQQAVTNSKQSHFWLDCSCLHLSERNATQWGRLAINASH 73
            ||:.|..:.....|.|..|.|  ||.....:.::..:|                           
Mosquito     7 PLSRPTKAPKCDQTFVSRAGGPSNGTFSAPMLSNPSNH--------------------------- 44

  Fly    74 SLGAKNNCLMIFIAG----MDDELVAFQLEQLQLRAGCL-DSVDIFPYLREPVIENATLAADTF- 132
                ...||.||:||    :|....:|.|....  ..|: :.:|::..::..  :.|.|....| 
Mosquito    45 ----SRQCLYIFLAGPGQRVDVSFTSFSLRGTP--PDCVHEYMDVYAEVQSS--DPAELINSPFG 101

  Fly   133 ---CQHSRERSATPIYSAGRLLGLRLRFQQPPTDLASWNLTL-NASYRFLKRENFRTDGRLVPHS 193
               |.....|....:|.|     :.|.|.   ||..|....: ...|.|:....:.. |:.|..|
Mosquito   102 GRYCGPIPPRRRISLYRA-----IALSFY---TDKNSTTPDIFEGRYAFINETEYEI-GQPVIGS 157

  Fly   194 FCDFYFFASLSGEEANMGQ---GYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVV 255
            .|.:..         |..|   |...||.:|..||..:.|.|:|||:|...|.|.|.:..|    
Mosquito   158 PCSYVI---------NFAQKRTGAIISPTYPGAYPKDMSCTYQFIGKPSQRVRIEFRDFDL---- 209

  Fly   256 SGGCQLDALTLFDAESAHMNSVIDVICSSRPTRRLVSTGPDLLLEFNA---SSNRTAKGFRGKYK 317
               |..|.:.:||... :.::||...|..:....|.|:...|.:.|:.   ::|...:||:|.::
Mosquito   210 ---CPFDYVRVFDGPD-NTSAVIGTYCGQQRNLVLYSSEHYLFIHFSTLQRTANTQNRGFKGIFE 270

  Fly   318 FVSNDLGVPNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFD 382
            |                    :...||.:.:::......:.:                :|.|...
Mosquito   271 F--------------------SESFVKLDFIRENDGMHIRGS----------------ECDQKIL 299

  Fly   383 SRVNKSG-IFDSNQLL--LAKHALGGVVIGGSRVLQCRYEF----EAQAPERVQIRFHDFNVPT- 439
            |:...:| ::..|...  :.|             :.|||..    :||..|||::.|..|.:|. 
Mosquito   300 SKKESTGFVYSPNYPFPYIPK-------------VVCRYFVYGMQDAQNLERVKLEFSIFEIPKG 351

  Fly   440 EH--ENSTGCQPGDALHVVTELRGRYETQEL----------LCGAFLPKPLMSSGQQLHLQFVGK 492
            ||  ::.:.|..|   ::...|:|    ||:          |||..||..::|.|.:|.:.|   
Mosquito   352 EHKDKSESNCTDG---YLKVYLKG----QEVADAYDKFDHELCGGELPHAVISDGPRLVMVF--- 406

  Fly   493 YPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEG-CSFVYNSSERISGLFHSPNFPGYYLENVVC 556
                .:.::|..||:|:|.|.|.:.|......:| |||.|.|:.|..|.|:||.:|..|.....|
Mosquito   407 ----SSGELQGRGFKAKYTFETEYKIPGTAAPDGTCSFTYRSTSRKKGEFNSPRYPSNYPSETNC 467

  Fly   557 NYYFYGASDERVVLHFTYFDIEGIGS-----------CDHQTASDYIEFSNFMSTDRKFSRYCGK 610
            :|.|....:|:|.:.|.:|.::..|:           |.......|:.:.:  .|||...|||..
Mosquito   468 SYVFLATPNEQVTIVFDHFKVKADGANTTGGAYGASVCFEDWLEMYVLYRD--GTDRFLGRYCSL 530

  Fly   611 LPDFEMRSD-GRF-FRVTLHSNDRFVAIGFRALYTFET 646
            .....:.|. |.. .||.||::...||.||:|.|.|||
Mosquito   531 TAPGPVESPRGAVGIRVVLHTDLENVASGFKARYIFET 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 34/128 (27%)
CUB <414..512 CDD:238001 33/114 (29%)
CUB 527..644 CDD:238001 40/129 (31%)
AgaP_AGAP001415XP_321719.5 CUB 27..142 CDD:238001 28/157 (18%)
CUB 159..271 CDD:238001 34/128 (27%)
CUB 303..422 CDD:238001 36/145 (25%)
CUB 438..566 CDD:238001 40/129 (31%)
CUB 576..699 CDD:238001
LDLa 718..754 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D179423at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.