DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and AgaP_AGAP001622

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_321477.2 Gene:AgaP_AGAP001622 / 1281552 VectorBaseID:AGAP001622 Length:212 Species:Anopheles gambiae


Alignment Length:85 Identity:20/85 - (23%)
Similarity:32/85 - (37%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 GVPNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFDSRVN-K 387
            |....:.|.|:...|.|     ::.....:|:.|.....|.|.:....:...:.|:.|....| |
Mosquito    25 GADTPAAPTPSDSAAGS-----QRGSTRGSSSRKAKKAPSSVFVLFSQKQIAEFKEAFALMDNDK 84

  Fly   388 SGIFDSNQLLLAKHALGGVV 407
            .|:...|.|.....|||.:|
Mosquito    85 DGVIGKNDLRSTFDALGKLV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001
AgaP_AGAP001622XP_321477.2 PTZ00184 66..204 CDD:185504 11/39 (28%)
EFh 72..>116 CDD:298682 11/33 (33%)
EF-hand_8 154..>195 CDD:290545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.