DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sol1 and LOC1276971

DIOPT Version :10

Sequence 1:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_061505119.1 Gene:LOC1276971 / 1276971 VectorBaseID:AGAMI1_001308 Length:204 Species:Anopheles gambiae


Alignment Length:79 Identity:19/79 - (24%)
Similarity:27/79 - (34%) Gaps:27/79 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 PTEHENSTGCQPGDAL------HVVTELR--------------GRYETQELLCGAFLPKP----- 477
            ||....|...:|...:      |.|.|||              ||.|.:::|...:...|     
Mosquito    43 PTNKPGSAKKRPTSNVFSVLEQHQVAELRELFNLLDTSHAGVVGREELRDMLTVWYERAPTEQLL 107

  Fly   478 --LMSSGQQLHLQF 489
              ||:..:.|.|.|
Mosquito   108 DELMAEARGLPLNF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sol1NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 19/79 (24%)
CUB 527..644 CDD:238001
LOC1276971XP_061505119.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.