DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sol1 and MYL12A

DIOPT Version :10

Sequence 1:NP_001097756.1 Gene:Sol1 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001289978.1 Gene:MYL12A / 10627 HGNCID:16701 Length:177 Species:Homo sapiens


Alignment Length:48 Identity:11/48 - (22%)
Similarity:19/48 - (39%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 ENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQF 489
            |.:||....|.|..:....|...|.|.:...:...|:...|...:::|
Human   117 EEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sol1NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 11/48 (23%)
CUB 527..644 CDD:238001
MYL12ANP_001289978.1 PTZ00184 30..168 CDD:185504 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.