DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and gprin3

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_017951795.1 Gene:gprin3 / 101733019 XenbaseID:XB-GENE-6468967 Length:725 Species:Xenopus tropicalis


Alignment Length:426 Identity:88/426 - (20%)
Similarity:139/426 - (32%) Gaps:143/426 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 LDALTLFDAESAHMNSVIDVICSSR---------PTRRLVSTGPDLLLEFNASSNRTAKGFRGK- 315
            ||..|..|.:|...|:::..:.|:.         ..:.||.:.||..|: :...|:.|...... 
 Frog   126 LDEKTANDEKSVKDNTLVAPLVSAEAGMQVSSDFKNKPLVESEPDKGLD-SLLQNKEADPSLPSL 189

  Fly   316 --YKFVSNDLGVPNASVPPPAVLEAASVVVKQ-------------EKLQQEQASAAKENSLMSDV 365
              :|..|.:.|..|||    .::|:..|:..:             .||..|:....|||   .:|
 Frog   190 PTHKTESINSGTQNAS----TIIESEGVITAEGESTKDSITSNECHKLSFEKDKIKKEN---EEV 247

  Fly   366 ELSKPGRS-FEQCK----------QTFDSRV-------NKSGIFDSNQLLLA---------KHAL 403
            |...|..| |::..          .|.|:.|       ||| :..|..:|.|         |...
 Frog   248 ETDPPLPSRFKEMGTMTSFSLENWTTQDAEVQAVANVENKS-VSTSPSILAAFLKANSPALKERQ 311

  Fly   404 GGVVI------GGSRVLQCRYEFEA-------------QAPERVQ---IRFH-----DFNVPTEH 441
            ..|.|      |.|::.:..:..:|             |||:.:.   ::.|     |...||..
 Frog   312 EQVCIIYQGNPGASQLDRANFALQAQLSQNQLAPKLCFQAPDALSSQPLQMHTKSPPDLARPTFQ 376

  Fly   442 ENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGF 506
            ....| :....|:     |...|.|. ||...:|:..|:|..           |.:.|....|..
 Frog   377 HTEIG-RNSQILY-----RNEIEGQG-LCFREMPQMQMASPS-----------PILMNVKPVYQI 423

  Fly   507 RAEYRFLTNFGIMSGIQKEGCSFVYNSSE---RISGLFHSP-NFPGYYLENVVCNYYFYGASDER 567
            ..|                      ||::   |...::..| :|....:.|....::..|.  |.
 Frog   424 NIE----------------------NSAQPKPRTMDMYSEPSHFRAPEINNKSRLHHLSGV--EN 464

  Fly   568 VVLHFTYFDIEGIGSCDHQTASDYIEFSNFMSTDRK 603
            :.||....|       :.||  |.:......|||||
 Frog   465 IQLHNIRLD-------NDQT--DTLSIPGDDSTDRK 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 14/68 (21%)
CUB <414..512 CDD:238001 22/118 (19%)
CUB 527..644 CDD:238001 19/81 (23%)
gprin3XP_017951795.1 GRIN_C 600..720 CDD:373668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.