DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and ovch2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:363 Identity:86/363 - (23%)
Similarity:131/363 - (36%) Gaps:88/363 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 GRSFEQCKQTFDSRVNKSGIFDSNQLLL--------------AKHALG---GVVIGGSRVLQ--- 415
            |||::.......:|....|||...|.||              :|.:..   ||:.|.|.||:   
 Frog   278 GRSWKNNMFLPANRKGSPGIFTDIQKLLGWVSFQLNTAVTKESKESCSVQDGVLSGKSGVLRFPH 342

  Fly   416 -----------CRYEFEAQAPERVQIRFHDFNVPTEHENSTGCQPGDALHVVT---ELRGRYETQ 466
                       ||:.|.......:.:.|..|:|    |:...|.. |.|.:.|   .|.|::   
 Frog   343 KNNLRYRNNELCRWNFTVPKNMHILLNFTHFDV----ESDISCNL-DYLAIYTASDRLIGKF--- 399

  Fly   467 ELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQ-----KEG 526
               ||...|:.|:.|...:.|:|...:....|      ||...|         |.::     ..|
 Frog   400 ---CGDMPPRSLLISFSSIKLKFYSDFHKNHT------GFNLSY---------SAVEPNTYPDSG 446

  Fly   527 C-SFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASD 590
            | ||.....|   |...|.|:|..||.|..|::..:|..|..:.|.|..|.:|....|.:    |
 Frog   447 CGSFAVIFEE---GEIQSMNYPENYLGNSRCHWIIHGPPDSYIKLEFEDFALEPSDGCRY----D 504

  Fly   591 YIEFSNFMSTDRKFSRYCG-KLPDFEMRSDGRF---FRVTLHSNDRFVAIGFRALYTF------- 644
            |:.....::.:.....:|| .|||..:.:.|..   |......||:    ||||.:||       
 Frog   505 YLAVYQDLAAEDIIETFCGYSLPDLVLSTTGVMHIKFSTDERENDK----GFRATFTFVNPNSLN 565

  Fly   645 ETVSVNNSITDLRDNASMQSFVSTASTQPVANVNKLIA 682
            |.....|.:...::..:.|..:...|..|...::..||
 Frog   566 EDSRQGNRVKSNKEQTTSQDSICGVSQVPPRFISNSIA 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 25/114 (22%)
CUB 527..644 CDD:238001 34/121 (28%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 10/30 (33%)
CUB 330..436 CDD:238001 29/131 (22%)
CUB 447..558 CDD:238001 34/121 (28%)
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.