DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and neto2b

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_003200473.1 Gene:neto2b / 100034584 ZFINID:ZDB-GENE-060503-638 Length:537 Species:Danio rerio


Alignment Length:257 Identity:43/257 - (16%)
Similarity:95/257 - (36%) Gaps:61/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 GYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEEL-QLPPVVSGGCQLDALTLFDAESAHMNS 276
            |.|.||.:|:.||.:.:|.|.....|...::::|::: .:.|  |..|:.|.:.:.|.... .:.
Zfish    49 GTFSSPNYPSTYPPNKECVYILEAHPRKRIQLVFDDIYHIEP--SFECRFDNIEIRDGPFI-FSP 110

  Fly   277 VIDVICSSRPTRRLVSTGPDLLLEFNASSNRTAKGFRGKYKFVSNDLGVPNASVPPPAVLEAASV 341
            :|:..|..:....:.|:|..|.::|.:.......||:.:|.:.::          |...|....:
Zfish   111 LINRFCGDKSPGIVTSSGRFLWIKFTSDEELEELGFKVEYSYTAD----------PDFHLHVGGL 165

  Fly   342 VVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGV 406
            :......|.|.:.|                          |..:..|.:.:.|:           
Zfish   166 LNPIPDCQFEMSGA--------------------------DGVIRSSQVEEENK----------- 193

  Fly   407 VIGGSRVLQCRYEFEAQAPERVQIRFHDFNVPTEHENSTGCQPG-----DALHVVTELRGRY 463
             :.....:.|.:...|....::.:||.|:.:    |||..|:..     :..:.:.:|:.::
Zfish   194 -VKAGEAVDCIWTIRAPPMSKIYLRFLDYQL----ENSNECKKNFVAVYEGSNAIEDLKAKF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 25/105 (24%)
CUB <414..512 CDD:238001 10/55 (18%)
CUB 527..644 CDD:238001
neto2bXP_003200473.1 CUB 39..151 CDD:238001 24/104 (23%)
CUB <200..286 CDD:238001 10/55 (18%)
LDLa 292..326 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.