DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and masp1

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001373185.1 Gene:masp1 / 100002060 ZFINID:ZDB-GENE-110421-4 Length:740 Species:Danio rerio


Alignment Length:268 Identity:60/268 - (22%)
Similarity:103/268 - (38%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 EFEAQAPERVQIR--FHDFNVPTEHENSTGCQPGDALHVVTELRGRYETQELLCG------AFLP 475
            ::....|:..|||  |..|::    |.|..|: .|.|.|.:::    |...:.||      ..:|
Zfish    47 QWNITVPDGYQIRLYFMHFDI----EPSYLCE-YDYLKVYSDI----EELAVFCGREKTDTERVP 102

  Fly   476 KP--LMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEY-------------------RFLTN---- 515
            ..  ::|.|..|.:.|...:    :|:.:|:||.|.:                   .|..|    
Zfish   103 ASDIILSPGNVLSVAFRSDF----SNEERYFGFEAHFSAIDVDECRDRNDEDLVCDHFCHNYIGG 163

  Fly   516 ------FGIMSGIQKEGCSFVYNS---SERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLH 571
                  ||.:.......|....|.   :|| ||...|.:||..|.::..|.|........:|.|.
Zfish   164 FYCSCRFGFLLHSDNRTCKVECNKNVYTER-SGEITSADFPKAYPKSSECKYSIELEEGFQVSLE 227

  Fly   572 F-TYFDIEGIGSCDHQTASDYIEFSNFMSTDRKFSRYCGKLPDFEMRSDGRFFRVTLHSNDRFVA 635
            | ..||||     ||...|...:|....:.:::|..:||:....::::......:..||::....
Zfish   228 FDDTFDIE-----DHPEVSCPYDFIKIQAGEKEFGPFCGEKSPGKIQTGSNIVNILFHSDNSGEN 287

  Fly   636 IGFRALYT 643
            :|::..||
Zfish   288 LGWKLTYT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 25/121 (21%)
CUB 527..644 CDD:238001 31/121 (26%)
masp1NP_001373185.1 CUB 29..135 CDD:214483 25/100 (25%)
FXa_inhibition 143..181 CDD:405372 4/37 (11%)
CUB 189..294 CDD:395345 27/110 (25%)
PHA02639 <300..>425 CDD:165022
Sushi 301..362 CDD:395037
Tryp_SPc 465..729 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.