DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and URE2

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:51/182 - (28%)
Similarity:74/182 - (40%) Gaps:56/182 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEG---LVLWESRAILSYLVAAYGK---SDQL 106
            :||.|       ||...|:||::||...||.:.|.|   |.:|||.|||.:||..|.|   :..|
Yeast   144 LDFNL-------GEHRAPEFVSVNPNARVPALIDHGMDNLSIWESGAILLHLVNKYYKETGNPLL 201

  Fly   107 YPTDIRVRALVDQRLQFDLG--------TLYMRLTDYYFPTMFIGAPL----DEGKRA------K 153
            :..|:..::.::..|.|...        .|:.|    ||.:..|.:.:    ||.:|.      .
Yeast   202 WSDDLADQSQINAWLFFQTSGHAPMIGQALHFR----YFHSQKIASAVERYTDEVRRVYGVVEMA 262

  Fly   154 LAE----AVGWLNT------------ILEGRQFS-----AADHFTIADLTLL 184
            |||    .|..|:|            :.:.|.|.     ..|..|||||..:
Yeast   263 LAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADLAFV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 22/52 (42%)
GST_C_Delta_Epsilon 112..231 CDD:198287 24/112 (21%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 24/56 (43%)
GST_C_Ure2p 208..350 CDD:198326 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2827
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1709
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.