DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GTT1

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:42/224 - (18%)
Similarity:82/224 - (36%) Gaps:51/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MSPPVL--YYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTM----- 79
            ||.|::  ::|..|...| :|.|...|::::|:.........:..|:...::|....|.:     
Yeast     1 MSLPIIKVHWLDHSRAFR-LLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDR 64

  Fly    80 -NDEGLVLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYY------- 136
             ..:..:|.||..|..|::..:..|..|...|..:...::..|.:..|:|...|...:       
Yeast    65 ETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKD 129

  Fly   137 ----FPTMFIGAPLDEGKRAKLAEA----------------VGWLNTILEGRQFSAADHFTIADL 181
                ||..::...:.:    |:::|                :...|..|...:.|.||       
Yeast   130 SGMPFPISYLARKVAD----KISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGAD------- 183

  Fly   182 TLLVTVSQLEAFEFEL---RPYKHIRQWL 207
             :|::.....|||.:.   ..|..|.:||
Yeast   184 -ILMSFPLQMAFERKFAAPEDYPAISKWL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 16/80 (20%)
GST_C_Delta_Epsilon 112..231 CDD:198287 21/126 (17%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 15/81 (19%)
GST_C_GTT1_like 93..218 CDD:198298 22/131 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.