DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTF14

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:210 Identity:54/210 - (25%)
Similarity:84/210 - (40%) Gaps:50/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IDFELKIVNILEGEQLKPDFVA-MNPQHCVPTMNDEGLVLWESRAILSYLVAAY-GKSDQLYPTD 110
            :||||..|:.|.||.....|:: :||...||.:.|..|.|:|.:||..||...| .....|.|.|
plant    28 LDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNLLPDD 92

  Fly   111 IRVRALVDQRLQFDLGTLYMRLTDYYFPTMFI----GAPLD----EGKRAKLAEAVGWLNTILEG 167
            .:.||::...::.| ...::.:.......:.|    |...|    :..:.||:|.:....|.|..
plant    93 PKKRAIMSMWMEVD-SNQFLPIASTLIKELIINPYQGLATDDTAVQENKEKLSEVLNIYETRLGE 156

  Fly   168 RQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAPFDY------EELN--- 223
            ..:.|.:.|::|||                              .|:||.||      |||.   
plant   157 SPYLAGESFSLADL------------------------------HHLAPIDYLLNTDEEELKNLI 191

  Fly   224 ANKANMLADMFKAKM 238
            .::.|:.|.:.|.||
plant   192 YSRPNVAAWVEKMKM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 21/50 (42%)
GST_C_Delta_Epsilon 112..231 CDD:198287 25/135 (19%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 21/51 (41%)
GST_C_Phi 94..214 CDD:198296 29/144 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.