DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTF6

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:197 Identity:54/197 - (27%)
Similarity:85/197 - (43%) Gaps:31/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSY 95
            |.|...|.:|:.....::|||...|.:.:||..|..|:..||...||...|....::|||||..|
plant    10 PASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQY 74

  Fly    96 LVAAYG-KSDQLYPT--DIRVRAL-----------VDQRLQFD--LGTLYMRLTDYYFPTMFIGA 144
            :...:. |.:.|..|  |:.:.|:           |..:|.::  |..||...||         .
plant    75 IAH
EFSDKGNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMTTD---------K 130

  Fly   145 PLDEGKRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFE----FELRPYKHIRQ 205
            .:.|.:.||||:.:......|...::.|:||||:.||..:..:..|....    |:.||  |:..
plant   131 TVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQYLLGTPTKKLFDERP--HVSA 193

  Fly   206 WL 207
            |:
plant   194 WV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 23/66 (35%)
GST_C_Delta_Epsilon 112..231 CDD:198287 27/113 (24%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 23/66 (35%)
GST_C_Phi 91..208 CDD:198296 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.