DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTF4

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:233 Identity:58/233 - (24%)
Similarity:88/233 - (37%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSY 95
            |.|...|.:|.:.....:.:|...|.:..||.....|:::||...||...|..:.|:|||||..|
plant    43 PFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQY 107

  Fly    96 LVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYM--------------RLTDYYFPTMFIGAPL 146
            :  ||..|.       |...|::.|....:.||.|              :||.........|...
plant   108 I--A
YVHSS-------RGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYGLET 163

  Fly   147 DE----GKRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFE----FELRPYKHI 203
            |:    ...|.|.:.:......||..:|.|.:.||:.||..|..:..|....    ||.|  ..:
plant   164 DQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKLFEKR--SKV 226

  Fly   204 RQWLDRCKDHMAPFDYEELNANKA-NMLADMFKAKMNQ 240
            |:|:|            |:.:.:| .|..|..|:..|:
plant   227 RKWVD------------EITSREAWKMACDQEKSWFNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 21/66 (32%)
GST_C_Delta_Epsilon 112..231 CDD:198287 31/141 (22%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 21/67 (31%)
GST_C_Phi 126..243 CDD:198296 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.