DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTT2

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:227 Identity:64/227 - (28%)
Similarity:107/227 - (47%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97
            |.|.|::|:..|:.:|.|:..::::.:.:||.|:|..:||...||.:.|..|.|:||.|||.||.
plant    11 SQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFESHAILIYLS 75

  Fly    98 AAYGK-SDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMF---IGAPLDEGKRAK----L 154
            :||.. .|..||.|:..||.:...|.:....|....:.|...::.   :|.||:....|:    |
plant    76 SAY
ASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPKAAAEAENIL 140

  Fly   155 AEAVGWLNT---------ILEGRQFSAADHFTIADLTLLVTVSQLEAFEFE-----LRPYKHIRQ 205
            ..::..|.|         :|.|:|.|      ||||:|:..:.||:..:.:     |.|:|.:.|
plant   141 TNSLSTLETFWLKGSAKFLLGGKQPS------IADLSLVCELMQLQVLDDKDRLRLLSPHKKVEQ 199

  Fly   206 WLDRCKDHMAPFDYEELNANKANMLADMFKAK 237
            |::..:....|...|....        :|:||
plant   200 WIESTRKATMPHSDEVHEV--------LFRAK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 25/64 (39%)
GST_C_Delta_Epsilon 112..231 CDD:198287 30/139 (22%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 25/66 (38%)
GST_C_Theta 92..221 CDD:198292 30/142 (21%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.