DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTF12

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:171 Identity:47/171 - (27%)
Similarity:72/171 - (42%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLVAAYGKS 103
            :||......|:||:..:::...||.||:.:...|...||.:.|....|:|||||..|....:  :
plant    17 VLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKF--A 79

  Fly   104 DQ---LYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMF------------IGAPLD----EG 149
            ||   |....:..||:|||         :..:..|||..:.            :|...|    |.
plant    80 DQGTNLLGKSLEHRAIVDQ---------WADVETYYFNVLAQPLVINLIIKPRLGEKCDVVLVED 135

  Fly   150 KRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQL 190
            .:.||...:...|..|...:|.|.:.||:||||.:..:..|
plant   136 LKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 20/58 (34%)
GST_C_Delta_Epsilon 112..231 CDD:198287 24/95 (25%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 47/171 (27%)
GST_N_Phi 2..77 CDD:239351 20/59 (34%)
GST_C_Phi 91..209 CDD:198296 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.