DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTF2

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:198 Identity:52/198 - (26%)
Similarity:84/198 - (42%) Gaps:29/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSY 95
            |.|...|.:|:.....::||||..|.:.:||..|..|::.||...||...|..|.|:|||||..|
plant    10 PASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQY 74

  Fly    96 LVAAY-GKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTM------------FIGAPLD 147
            :...| .:...|..||.:      ...|:.:..:.|::.|:.|..:            ..|...|
plant    75 IAHR
YENQGTNLLQTDSK------NISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTD 133

  Fly   148 EG----KRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFE----FELRPYKHIR 204
            |.    :.||||:.:......|:..::.|.:.||:.||..:..:..|....    |..||  .:.
plant   134 EAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERP--RVN 196

  Fly   205 QWL 207
            :|:
plant   197 EWV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 26/66 (39%)
GST_C_Delta_Epsilon 112..231 CDD:198287 22/116 (19%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 26/67 (39%)
GST_C_Phi 96..211 CDD:198296 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.