DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:234 Identity:55/234 - (23%)
Similarity:88/234 - (37%) Gaps:68/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LRGGKMSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMND 81
            |.|.:||..|          ..:||.....:.:|||..||:.......|.|::|||...||.:.|
plant     5 LYGDEMSACV----------ARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQD 59

  Fly    82 EGLVLWESRAILSYLVAAYGK--SDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYF-PTM--- 140
            :.|.|:|||||.:|:...:..  :|.....|.:..|:|         .|:..:..::| |.:   
plant    60 DDLTLFESRAITAYIAEKHRDKGTDLTRHEDPKEAAIV---------KLWSEVEAHHFNPAISAV 115

  Fly   141 ---FIGAPLD-EGKRAKLAEA----VGWLNTILEGR----QFSAADHFTIADLTLLVTVSQLEAF 193
               .|..||. |...|.:.|.    :|.:..:.|.|    ::.|.|.:|:|||            
plant   116 IHQLIVVPLQGESPNAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADL------------ 168

  Fly   194 EFELRPYKHIRQWLDRCKDHMAPFDYEELNANKANMLAD 232
                               |..|:.|..:....|.::.|
plant   169 -------------------HHVPYTYYFMKTIHAGLIND 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 112..231 CDD:198287 24/134 (18%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 55/234 (24%)
GST_N_Phi 2..77 CDD:239351 28/81 (35%)
GST_C_Phi 92..208 CDD:198296 25/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.