DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTF8

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:202 Identity:58/202 - (28%)
Similarity:88/202 - (43%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILS 94
            :|.|.....:|......|:.|||..|::..|...:...:|:||...:|.:.|..|.|:|||||..
plant    57 VPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQ 121

  Fly    95 YLVAAYG-KSDQLYPTDI-RVRALVDQRL-----QFDLGTLYMRLTDYYFPTMFIGAPLD----- 147
            ||...|. |.::|...|. :|:|..:..|     |||.....:.. :..|..|| |...|     
plant   122 YLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAF-ERVFKGMF-GMTTDPAAVQ 184

  Fly   148 --EGKRAKLAEAVGWLNTILEGR----QFSAADHFTIADLTLLVTVSQLEAFE----FELRPYKH 202
              |||..|:.:       :.|.|    :|.|.|.||:|||..|..:..|...:    |:.||  .
plant   185 ELEGKLQKVLD-------VYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRP--K 240

  Fly   203 IRQWLDR 209
            :.:|:.:
plant   241 VSEWIKK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 23/67 (34%)
GST_C_Delta_Epsilon 112..231 CDD:198287 31/118 (26%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.