DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTF9

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:189 Identity:51/189 - (26%)
Similarity:84/189 - (44%) Gaps:17/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97
            ||....:.|:.|  .:.||...|::::||..:|.::|:.|...||.:.|....::||||::.|:.
plant    12 SPKRALVTLIEK--GVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVA 74

  Fly    98 AAY-GKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMF---IGAPLDE----GKRAKL 154
            ..| .:...|....:..|..|:|.|..:..|.:..|.:.....||   :|.|.||    ....||
plant    75 EKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKLIKESEEKL 139

  Fly   155 AEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQL-----EAFEFELRPYKHIRQWLD 208
            |..:......|...::.|.|..::|||..|.....|     :|:..:.|  ||:..|.|
plant   140 AGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKDR--KHVSAWWD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 20/64 (31%)
GST_C_Delta_Epsilon 112..231 CDD:198287 29/109 (27%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 51/189 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.