DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and Gstz1

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001102915.1 Gene:Gstz1 / 681913 RGDID:1589363 Length:216 Species:Rattus norvegicus


Alignment Length:216 Identity:58/216 - (26%)
Similarity:95/216 - (43%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LRGGKMSPPVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNILE--GEQLKPDFVAMNPQHCVPT 78
            ::.||   |||| |...|...|..:.|| :..||:|:..:|:::  |:|...:|..:||...||.
  Rat     1 MQAGK---PVLYSYFRSSCSWRVRIALA-LKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPA 61

  Fly    79 MNDEGLVLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIG 143
            :..:|:.:.:|.|||.||... ....:|.|.|.:.||:|  |:..||                |.
  Rat    62 LKIDGITIGQSLAILEYLEET-RPIPRLLPQDPQKRAIV--RMISDL----------------IA 107

  Fly   144 APLDEGKRAKLAEAVG------W-----------LNTILEGR--QFSAADHFTIADLTLLVTVSQ 189
            :.:...:...:.:.||      |           |..||:..  ::...|..::||:.|...|:.
  Rat   108 SGIQPLQNLSVLKQVGQENQMPWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQVAN 172

  Fly   190 LEAFEFELRPY---KHIRQWL 207
            .|.|:.:|.||   .||.:.|
  Rat   173 AERFKVDLSPYPTISHINKAL 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 27/75 (36%)
GST_C_Delta_Epsilon 112..231 CDD:198287 26/118 (22%)
Gstz1NP_001102915.1 GST_N_Zeta 6..80 CDD:239340 26/74 (35%)
maiA 7..211 CDD:273527 55/207 (27%)
Glutathione binding. /evidence=ECO:0000250 14..19 1/4 (25%)