DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gstt1a

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:246 Identity:72/246 - (29%)
Similarity:110/246 - (44%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWE 88
            |..||....|.||||:.:.||:..|.||.|.|::..|||...:|..::....||.:.|...:|.|
Zfish     2 PLELYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTE 66

  Fly    89 SRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYF-----PTMFIGAPLDE 148
            |.|||.||...:...|..||.|::.||.||:.|.:....:....:..::     |.: .|||:  
Zfish    67 SIAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKVFWFKGVLPAV-TGAPV-- 128

  Fly   149 GKRAKLAEAVGWLN--------TILEGRQFSAADHFTIADLTLLVTVSQLEAF---EFELRPYKH 202
             .:.|:..|:..||        ..|:.|.|...|..::||:..:|.:.|..|.   .||.||  .
Zfish   129 -PKEKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVATGVDVFEGRP--A 190

  Fly   203 IRQWLDRCKDHMAPFDYEELNANKANM-------------LADMFKAKMNQ 240
            :..|.||.|..:....::|  |:|..|             |.:.||.|:.:
Zfish   191 LSAWRDRVKKEVGVELFDE--AHKVIMNVESLPQTFENKGLPEFFKLKIQK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 29/72 (40%)
GST_C_Delta_Epsilon 112..231 CDD:198287 34/147 (23%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 62/201 (31%)
GST_N_Theta 3..78 CDD:239348 29/74 (39%)
GST_C_Theta 91..217 CDD:198292 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.