DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstD5

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:210 Identity:90/210 - (42%)
Similarity:129/210 - (61%) Gaps:3/210 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAI 92
            ||.|....||:::::||.|.:...:|::|.||.:||||:||.:||||.:||:.|.|..:||||||
  Fly     4 YYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68

  Fly    93 LSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAEA 157
            ..|||..|||.|.|:|.|.:.:|||:|||.||:||||.....||:|....|.|..:....|:..:
  Fly    69 AVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKIESS 133

  Fly   158 VGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAPFDYEEL 222
            ..:||..|||:.:.|.||.|:||:.:|.|||..|.|:|:|..|.::.:|....| .:.| .:|| 
  Fly   134 FEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVARWYANAK-KVTP-GWEE- 195

  Fly   223 NANKANMLADMFKAK 237
            |...|..|..:|.|:
  Fly   196 NWKGAVELKGVFDAR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 34/69 (49%)
GST_C_Delta_Epsilon 112..231 CDD:198287 45/118 (38%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 81/179 (45%)
GST_N_Delta_Epsilon 1..74 CDD:239343 34/69 (49%)
GST_C_Delta_Epsilon 88..204 CDD:198287 45/118 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.