DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstD3

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:171 Identity:73/171 - (42%)
Similarity:108/171 - (63%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLVAAYGKSDQ 105
            ::.|.|.::|..||:|.|:|||:.|||:.:||||.:||:.|.|..:|||||||.|||..|||.|.
  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65

  Fly   106 LYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAEAVGWLNTILEGRQF 170
            |||.||:.:|:::|||.||:..:|..|.:||:.....|....|....|:.|...:|||.|||:.:
  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQDY 130

  Fly   171 SAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCK 211
            .|.|.:|:||:.:|..||..:...|::..|.::.:|.|..|
  Fly   131 VAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 30/56 (54%)
GST_C_Delta_Epsilon 112..231 CDD:198287 33/100 (33%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 30/56 (54%)
GstA 6..173 CDD:223698 72/166 (43%)
GST_C_Delta_Epsilon 72..188 CDD:198287 33/100 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.