DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and gstt1

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:242 Identity:66/242 - (27%)
Similarity:104/242 - (42%) Gaps:29/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVL 86
            |:...||....|.||||:.:.||..:|.|....|.:.:||.|..::..:|....||.:.|....:
 Frog     1 MAELTLYLDLLSQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFM 65

  Fly    87 WESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKR 151
            .||.|:|.|:...:..:|..||:||:..|.||:.|.:.........:..::....  .||..|:.
 Frog    66 AESTAMLLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCL--TPLILGQE 128

  Fly   152 A---KLAEAVGWLNT--------ILEGRQFSAADHFTIADLTLLVTVSQLEA---FEFELRPYKH 202
            |   |:...|...||        .|..:.|.|.|..::|||..:|.:.|:.|   ..|:.||  .
 Frog   129 APAEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFDDRP--K 191

  Fly   203 IRQWLDRCKDHMAPFDYEE-----LNANK------ANMLADMFKAKM 238
            :..|..|..:.:....:.|     |||.|      |..|.:..|:|:
 Frog   192 LAAWKKRVVEALGEELFLEAHEGILNAKKMASEPLAPELMEFLKSKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 112..231 CDD:198287 33/143 (23%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 24/74 (32%)
GST_C_Theta 92..217 CDD:198292 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.