DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstZ2

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:216 Identity:51/216 - (23%)
Similarity:89/216 - (41%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILE--GEQLKPDFVAMNPQHCVPTMNDEGLVLW 87
            |:||....|.....:.:...:.:|.:::|.:::::  |||...::..:||...||.:..:|..|.
  Fly    16 PILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLI 80

  Fly    88 ESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRA 152
            ||.||:.||.....:. .|.|.|:..||.|.:.::.....:.        |...:...:..|:..
  Fly    81 ESVAIMHYLEETRPQR-PLLPQDVHKRAKVREIVEIICSGIQ--------PLQNLIVLIHVGEEK 136

  Fly   153 KLAEAVGW-----------LNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQW 206
            |...|..|           |:|  ...::...|..::||..|:..|.....|..:||||..|.: 
  Fly   137 KKEWAQHWITRGFRAVEKALST--SAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILR- 198

  Fly   207 LDRCKDHMAPFDYEELNANKA 227
            :||           ||.:|.|
  Fly   199 IDR-----------ELESNPA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 21/74 (28%)
GST_C_Delta_Epsilon 112..231 CDD:198287 27/127 (21%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 20/73 (27%)
maiA 17..221 CDD:273527 50/215 (23%)
GST_C_Zeta 104..217 CDD:198300 27/127 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.