DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstZ1

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:235 Identity:55/235 - (23%)
Similarity:93/235 - (39%) Gaps:61/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNILE---GEQLKPDFVAMNPQHCVPTMNDEGLV 85
            |:|| |.|.|...|..:.|| :..||:::|..::|:   |.....::..:||...||::..:|..
  Fly    34 PILYSYWPSSCSWRVRVALA-IKKIDYDIKPTSLLKTVSGHAYTDEYREVNPMQKVPSLKIDGHT 97

  Fly    86 LWESRAILSYLVAAYGKSDQLYPTD----IRVRALVD------QRLQFDLGTLYMRLTDYYFPTM 140
            |.:|.||:.||... .....|.|.|    .::|.:|:      |.||      .:.:.|:.    
  Fly    98 LCDSVAIIHYLEET-RPQPALLPQDPVKRAKIREIVELICSGIQPLQ------NVSVLDHI---- 151

  Fly   141 FIGAPLDEGKRAKLAEAVGWLNTILEGRQ---------FSAADHFTIADLTLLVTVSQLEAFEFE 196
                    ||...|..|..|::...:|.:         |...|..::||:.|:..|.....::.:
  Fly   152 --------GKDQSLQWAQHWISRGFQGLEKVLSHSAGKFCVGDELSMADICLVPQVRNARRYKAD 208

  Fly   197 LRPYKHIRQWLDRCKDHMAPFDYEELNANKANMLADMFKA 236
            |.||..|                  :..|:.....|:|||
  Fly   209 LTPYPTI------------------VRLNQELQELDVFKA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 25/76 (33%)
GST_C_Delta_Epsilon 112..231 CDD:198287 23/133 (17%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 24/75 (32%)
maiA 35..240 CDD:273527 54/234 (23%)
GST_C_Zeta 122..236 CDD:198300 27/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.