DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstE3

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:226 Identity:83/226 - (36%)
Similarity:127/226 - (56%) Gaps:20/226 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GKMSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGL 84
            ||::   ||.:..|||.||:||..:.|::||:.||||::|.|.|||:|:.:||.|.||.::|.|.
  Fly     2 GKLT---LYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGF 63

  Fly    85 VLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEG 149
            .|.:|.||.||||:.||::|.|||.|::.||:|||||.:|...:........||..:      |.
  Fly    64 YLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW------EN 122

  Fly   150 K----RAKLAEAVG---WLNTILEGRQFSAADHFTIADLTLLVTVSQLEAF-EFELRPYKHIRQW 206
            |    :|::....|   .||..||...:.|.|:.||||..::..::....| ..:...|..:..|
  Fly   123 KTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAW 187

  Fly   207 LDRCKDHMAPFDYEELNANKANMLADMFKAK 237
            :.|.|:  .|: |||.|.::|..:.:..|:|
  Fly   188 IKRIKE--LPY-YEEANGSRAAQIIEFIKSK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 36/72 (50%)
GST_C_Delta_Epsilon 112..231 CDD:198287 35/126 (28%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 73/201 (36%)
GST_N_Delta_Epsilon 4..77 CDD:239343 36/75 (48%)
GST_C_Delta_Epsilon 91..208 CDD:198287 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.