DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstE14

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:207 Identity:75/207 - (36%)
Similarity:112/207 - (54%) Gaps:14/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWES 89
            |:|||...|||.||.|:|.|:||||.||:.||:.:|||.:.||:|:||||.|||:....|||.:|
  Fly     6 PILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDS 70

  Fly    90 RAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTM---FIGAPLDEGKR 151
            .|||.:|...:.:...|:|.:...|..|...|.|:...|:.|.:|:...|:   |....:...:|
  Fly    71 HAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFANVDVAHHER 135

  Fly   152 AKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAP 216
             ||.||...:...||...|.|....|:|||:::.|:|.:... |.|..:..:|:|...       
  Fly   136 -KLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLM-FPLSQFPRLRRWFTA------- 191

  Fly   217 FDYEELNANKAN 228
              .::|:|.:||
  Fly   192 --MQQLDAYEAN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 41/72 (57%)
GST_C_Delta_Epsilon 112..231 CDD:198287 32/120 (27%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 73/204 (36%)
GST_N_Delta_Epsilon 6..79 CDD:239343 41/72 (57%)
GST_C_Delta_Epsilon 94..209 CDD:198287 32/119 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.