DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GstT3

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:218 Identity:68/218 - (31%)
Similarity:107/218 - (49%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KMSPPVLYYLP-PSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDF-VAMNPQHCVPTMNDEG 83
            :||.|:.||.. .|.|.|::.::.::.::.||..:|.:..||.|..|| ..:|....||.::|.|
  Fly    40 RMSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNG 104

  Fly    84 LVLWESRAILSYLVAAYGK-SDQLYPTDIRVRALVDQRLQFDLGTLYMRLT-DYYFPTMFIGAPL 146
            ..|.||.|||.|| :|.|| .:.|||.....::.||:.|::.  .:.:||| ..||.|::: .||
  Fly   105 YKLAESVAILRYL-SAKGKIPEHLYPKYFVDQSRVDEFLEWQ--HMSLRLTCAMYFRTVWL-EPL 165

  Fly   147 DEGK---RAKL-------------AEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEF 195
            ..|:   .||:             .|.| |    |||:.|......|:||:.....:.|....::
  Fly   166 LTGRTPSEAKIETFRMQMERNLDVVEEV-W----LEGKDFLTGSSLTVADIFAACEIEQTRMADY 225

  Fly   196 ELR-PYKHIRQWLDRCKDHMAPF 217
            ::| .|..||.||.|.:....|:
  Fly   226 DVRIKYPKIRAWLKRVRQSCNPY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 27/74 (36%)
GST_C_Delta_Epsilon 112..231 CDD:198287 33/124 (27%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 27/76 (36%)
GstA 47..243 CDD:223698 64/204 (31%)
GST_C_Theta 135..259 CDD:198292 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.