Sequence 1: | NP_001138040.1 | Gene: | GstD11 / 41512 | FlyBaseID: | FBgn0038029 | Length: | 243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350632.1 | Gene: | GSTZ1 / 2954 | HGNCID: | 4643 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 60/200 - (30%) |
---|---|---|---|
Similarity: | 93/200 - (46%) | Gaps: | 25/200 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 LLRGGKMSPPVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNILE--GEQLKPDFVAMNPQHCVP 77
Fly 78 TMNDEGLVLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFI 142
Fly 143 GAPLDEGKRAKL-----AEAVGW--LNTILEGRQ--FSAADHFTIADLTLLVTVSQLEAFEFELR 198
Fly 199 PYKHI 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD11 | NP_001138040.1 | GST_N_Delta_Epsilon | 25..98 | CDD:239343 | 28/75 (37%) |
GST_C_Delta_Epsilon | 112..231 | CDD:198287 | 26/100 (26%) | ||
GSTZ1 | NP_001350632.1 | maiA | 8..212 | CDD:273527 | 56/189 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |