DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTZ1

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:200 Identity:60/200 - (30%)
Similarity:93/200 - (46%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLRGGKMSPPVLY-YLPPSPPCRSILLLAKMLDIDFELKIVNILE--GEQLKPDFVAMNPQHCVP 77
            :...||   |:|| |...|...|..:.|| :..||:|...:|:::  |:|...||.|:||...||
Human     1 MTESGK---PILYSYFRSSCSWRVRIALA-LKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP 61

  Fly    78 TMNDEGLVLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFI 142
            |:..:|:.:.:|.||:.|| .....:.:|.|.|.:.||.|  |:..||      :.....|...:
Human    62 TLKIDGITIHQSLAIIEYL-EEMRPTPRLLPQDPKKRASV--RMISDL------IAGGIQPLQNL 117

  Fly   143 GAPLDEGKRAKL-----AEAVGW--LNTILEGRQ--FSAADHFTIADLTLLVTVSQLEAFEFELR 198
            ......|:..:|     |...|:  |..||:...  :...|..|:|||.|:..|:..|.|:.:|.
Human   118 SVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLT 182

  Fly   199 PYKHI 203
            ||..|
Human   183 PYPTI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 28/75 (37%)
GST_C_Delta_Epsilon 112..231 CDD:198287 26/100 (26%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 56/189 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.