DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTT2

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens


Alignment Length:188 Identity:59/188 - (31%)
Similarity:91/188 - (48%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97
            |.|.|::.:.||...|..||:.|::::|:....:|:.:|....:||:.|...:|.||.|||.||.
Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75

  Fly    98 AAYGKSDQLYPTDIRVRALVDQRLQFDL----GTLYMRL-TDYYFPTMFIGAPLD--EGKRAKLA 155
            ..|...|..||:|::.||.|.:.|.:..    ||..:.| .....|.:.:..|.:  |..|..:.
Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMD 140

  Fly   156 EAVGWL-NTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFEL---RPYKHIRQWLDR 209
            :|:.|| :..|..|.|.|....|:|||..|..:.|..|..:||   ||  .:..|..|
Human   141 QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRP--RLAAWRGR 196

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 23/64 (36%)
GST_C_Delta_Epsilon 112..231 CDD:198287 31/109 (28%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 23/66 (35%)
GstA 14..210 CDD:223698 57/185 (31%)