DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and Eef1e1

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001099576.1 Gene:Eef1e1 / 291057 RGDID:1311056 Length:174 Species:Rattus norvegicus


Alignment Length:188 Identity:45/188 - (23%)
Similarity:75/188 - (39%) Gaps:34/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ELKIVNILEGEQLKP--DFVAMNPQHCVPTMNDEGLVLWESRAILSYLVAAYGKSDQLYPTDIRV 113
            ||:::....|  |||  .:.|...:.......:.|..|.....|.::||....| :.|..:....
  Rat     6 ELRLLEKSLG--LKPGNKYSAQGERQVPVLQTNNGPSLMGLSTIATHLVKEANK-EHLLGSTAEE 67

  Fly   114 RALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAEAVGWLNTILEGRQFSAADHFTI 178
            :|||.|.|:|.:             |...|....|..:..|.:    ||:.||.:.:.|..:.|:
  Rat    68 KALVQQWLEFRI-------------TRVDGHSSKEDTQTLLKD----LNSYLEDKVYLAGHNTTL 115

  Fly   179 ADLTLL---------VTVSQLEAFEFELRPYKHIRQWLDRCKDHMAP--FDYEELNAN 225
            ||:.|.         :||.:.|.:....|.:.||:.:.| .:.|::.  |....|.||
  Rat   116 ADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPD-IRQHLSSVVFIKNRLYAN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 11/48 (23%)
GST_C_Delta_Epsilon 112..231 CDD:198287 31/125 (25%)
Eef1e1NP_001099576.1 GST_C_AIMP3 65..165 CDD:198338 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.