DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD11 and GSTT4

DIOPT Version :9

Sequence 1:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:232 Identity:53/232 - (22%)
Similarity:97/232 - (41%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRAILSYLV 97
            |.|||::.:.:|..||.|..:.|::|:|......::.:||...:|::.|...:|.||.|||.||.
Human    11 SAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSESAAILYYLC 75

  Fly    98 AAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRA---KLAEAVG 159
            ..|.......|.|...||.||:.:.:......:.:....:..:.|  |...|:..   |:..||.
Human    76 RKY
SAPSHWCPPDPHARARVDEFVAWQHTAFQLPMKKIVWLKLLI--PKITGEEVSAEKMEHAVE 138

  Fly   160 WLNT--------ILEGRQFSAADHFTIADLTLLVTVSQLEAFEFE--LRPYKHIRQWL------- 207
            .:..        .|:.:.|...:..::|||..:|.:.|..|..:.  |...| :.:|.       
Human   139 EVKNSLQLFEEYFLQDKMFITGNQISLADLVAVVEMMQPMAANYNVFLNSSK-LAEWRMQVELNI 202

  Fly   208 ---------DRCKDHMAPFDYEELNANKANMLADMFK 235
                     ||.. .:|.:|:..|::.....::::.|
Human   203 GSGLFREAHDRLM-QLADWDFSTLDSMVKENISELLK 238

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 23/64 (36%)
GST_C_Delta_Epsilon 112..231 CDD:198287 26/147 (18%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 23/66 (35%)